Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT5 Rabbit Polyclonal Antibody (Biotin)

SIRT5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SIR2L5

UniProt

Q9NXA8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIRT5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Human, Mouse, Porcine, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

NP_112534

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR) (MaxLight 650)
134538-ML650 100 µL

TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR) (MaxLight 650)

Sign In for Pricing
View Details
16q22/16q23 gene deletion probe reagent
FP-273 K Fast probe 100 μL (10-20T), DAPI Staining solution (20T)

16q22/16q23 gene deletion probe reagent

Sign In for Pricing
View Details
MLH3 Antibody
CSB-PA262280 100 µL

MLH3 Antibody

Sign In for Pricing
View Details
Bovine Eukaryotic Translation Initiation Factor 4E-Binding Protein 3 (EIF4EBP3) ELISA Kit
MBS9922067-01 48 Well

Bovine Eukaryotic Translation Initiation Factor 4E-Binding Protein 3 (EIF4EBP3) ELISA Kit

Sign In for Pricing
View Details
Bovine Eukaryotic Translation Initiation Factor 4E-Binding Protein 3 (EIF4EBP3) ELISA Kit
MBS9922067-02 96 Well

Bovine Eukaryotic Translation Initiation Factor 4E-Binding Protein 3 (EIF4EBP3) ELISA Kit

Sign In for Pricing
View Details
Bovine Eukaryotic Translation Initiation Factor 4E-Binding Protein 3 (EIF4EBP3) ELISA Kit
MBS9922067-03 5x 96 Well

Bovine Eukaryotic Translation Initiation Factor 4E-Binding Protein 3 (EIF4EBP3) ELISA Kit

Sign In for Pricing
View Details