Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD6 Rabbit Polyclonal Antibody (HRP)

PSMD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S10, Rpn7, p42A, p44S10, SGA-113M

UniProt

Q15008

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dimethylthiophene-3-carboxylic acid
OR1098231 1 Each

2,4-Dimethylthiophene-3-carboxylic acid

Sign In for Pricing
View Details
Mouse CLEC10A Matched Antibody Pair Set [ABP-S-051523]
ABP-S-051523 5 Plates

Mouse CLEC10A Matched Antibody Pair Set [ABP-S-051523]

Sign In for Pricing
View Details
Human CD184/CXCR4 Recombinant Protein
PPT-11257 100 µg

Human CD184/CXCR4 Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal Caveolin-3 Antibody
NBP2-58553-25ul 25 µL

Rabbit Polyclonal Caveolin-3 Antibody

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), 1mg/mL
BNUM1758-50 1x 50 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), 1mg/mL

Sign In for Pricing
View Details
Rat connective tissue growth factor, CTGF ELISA KIT
E0356Ra-01 48 Well

Rat connective tissue growth factor, CTGF ELISA KIT

Sign In for Pricing
View Details