Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRC Rabbit Polyclonal Antibody (FITC)

SRC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASV, SRC1, THC6, c-SRC, p60-Src

UniProt

P12931

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SRC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_938033

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution
FP33211-01 0.25 kg

Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution

Sign In for Pricing
View Details
Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution
FP33211-02 0.5 Kg

Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution

Sign In for Pricing
View Details
Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution
FP33211-03 1 Kg

Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution

Sign In for Pricing
View Details
Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution
FP33211-04 2 Kg

Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution

Sign In for Pricing
View Details
Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution
FP33211-05 5 Kg

Pyruvic aldehyde - Technical grade, 35-45% w/w aqueous solution

Sign In for Pricing
View Details
Pros1 3'UTR GFP Stable Cell Line
TU167026 1.0 mL

Pros1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details