Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOR1 Rabbit Polyclonal Antibody (Biotin)

NCOR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

N-CoR, TRAC1, N-CoR1, hN-CoR, PPP1R109

UniProt

Q60974

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

270kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta SNAP control peptide
112-2P 100 µg

Beta SNAP control peptide

Sign In for Pricing
View Details
Lentiviral mouse Psd2 shRNA (UAS) - Lentiviral mouse Psd2 shRNA (UAS, RFP) plasmid
GTR15231037 1 Vial

Lentiviral mouse Psd2 shRNA (UAS) - Lentiviral mouse Psd2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Pigeon Succinyl-Coa Ligase [ADP-Forming] Subunit Beta, Mitochondrial (SUCLA2) ELISA Kit
MBS9946112 Inquire

Pigeon Succinyl-Coa Ligase [ADP-Forming] Subunit Beta, Mitochondrial (SUCLA2) ELISA Kit

Sign In for Pricing
View Details
VE-cadherin Double Nickase Plasmid (h)
sc-400063-NIC 20 µg

VE-cadherin Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Olr400 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
34373156 3x 1.0 µg DNA

Olr400 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
UPF3A (NM_080687) Human Tagged Lenti ORF Clone
RC204333L3 10 µg

UPF3A (NM_080687) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details