Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOR1 Rabbit Polyclonal Antibody (Biotin)

NCOR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

N-CoR, TRAC1, N-CoR1, hN-CoR, PPP1R109

UniProt

Q60974

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

270kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Steel Tape Rules
2010920/3 1 Each

Steel Tape Rules

Sign In for Pricing
View Details
USP25, CT (Ubiquitin Carboxyl-terminal Hydrolase 25, Ubiquitin Thiolesterase 25, Ubiquitin-specific-processing Protease 25, Deubiquitinating Enzyme 25, USP on Chromosome 21, USP21) (APC)
MBS6505311-01 0.2 mL

USP25, CT (Ubiquitin Carboxyl-terminal Hydrolase 25, Ubiquitin Thiolesterase 25, Ubiquitin-specific-processing Protease 25, Deubiquitinating Enzyme 25, USP on Chromosome 21, USP21) (APC)

Sign In for Pricing
View Details
USP25, CT (Ubiquitin Carboxyl-terminal Hydrolase 25, Ubiquitin Thiolesterase 25, Ubiquitin-specific-processing Protease 25, Deubiquitinating Enzyme 25, USP on Chromosome 21, USP21) (APC)
MBS6505311-02 5x 0.2 mL

USP25, CT (Ubiquitin Carboxyl-terminal Hydrolase 25, Ubiquitin Thiolesterase 25, Ubiquitin-specific-processing Protease 25, Deubiquitinating Enzyme 25, USP on Chromosome 21, USP21) (APC)

Sign In for Pricing
View Details
Rabbit Anti Duck IgY (H&L) -AbFluor 680
SA1015-01 100 µL

Rabbit Anti Duck IgY (H&L) -AbFluor 680

Sign In for Pricing
View Details
Rabbit Anti Duck IgY (H&L) -AbFluor 680
SA1015-02 1 mL

Rabbit Anti Duck IgY (H&L) -AbFluor 680

Sign In for Pricing
View Details
Sirukumab Biosimilar - Research Grade
ICH5869-20mg 20 mg

Sirukumab Biosimilar - Research Grade

Sign In for Pricing
View Details