Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBL1 Rabbit Polyclonal Antibody (FITC)

RBL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRB1, p107, CP107

UniProt

P28749

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody
AP02559PU-S 50 µL

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-3), CF647 conjugate, 0.1mg/mL
BNC472495-500 1x 500 µL

Lactoylglutathione Lyase (CPTC-GLO1-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF568 conjugate, 0.1mg/mL
BNC683876-100 1x 100 µL

Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CacUL1 Mouse Gene Knockout Kit (CRISPR)
KN502440 1 Kit

CacUL1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Fatty Acid Synthase (FASN) activation kit by CRISPRa
GA101533 1 Kit

Human Fatty Acid Synthase (FASN) activation kit by CRISPRa

Sign In for Pricing
View Details
Zfp872 Mouse Gene Knockout Kit (CRISPR)
KN520016 1 Kit

Zfp872 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details