Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L2 Rabbit Polyclonal Antibody (HRP)

SEC14L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPF, TAP, TAP1, C22orf6

UniProt

O76054

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC14L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRG4 ELISA Kit (Human) (OKAN06417)
OKAN06417 96 Well

NRG4 ELISA Kit (Human) (OKAN06417)

Sign In for Pricing
View Details
HAV Capsid protein VP2 Antibody
E55A15993 100 µg

HAV Capsid protein VP2 Antibody

Sign In for Pricing
View Details
DIRC1 ORF Vector (Human) (pORF)
18242011 1.0 µg DNA

DIRC1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Syringaresinol diglucoside
BUP05094-01 1 mg

Syringaresinol diglucoside

Sign In for Pricing
View Details
Syringaresinol diglucoside
BUP05094-02 5 mg

Syringaresinol diglucoside

Sign In for Pricing
View Details
Syringaresinol diglucoside
BUP05094-03 10 mg

Syringaresinol diglucoside

Sign In for Pricing
View Details