Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZKSCAN5 Rabbit Polyclonal Antibody (FITC)

ZKSCAN5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZFP95, ZFP-95, ZNF914, ZSCAN37

UniProt

Q9Y2L8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZKSCAN5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45/PTPRC Rabbit Polyclonal Antibody
orb196266 100 µg

CD45/PTPRC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSMA4 Rabbit Polyclonal Antibody
E10G09878 100 µL

PSMA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bad, Phosphorylated (Ser99) (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) (AP)
MBS6464756-01 0.2 mL

Bad, Phosphorylated (Ser99) (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) (AP)

Sign In for Pricing
View Details
Bad, Phosphorylated (Ser99) (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) (AP)
MBS6464756-02 5x 0.2 mL

Bad, Phosphorylated (Ser99) (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) (AP)

Sign In for Pricing
View Details
Erp27 (NM_026983) Mouse Tagged Lenti ORF Clone
MR220459L4 10 µg

Erp27 (NM_026983) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
QPCR Kit RNA Foot and Mo - EACH
MOL8740 1 Each

QPCR Kit RNA Foot and Mo - EACH

Sign In for Pricing
View Details