Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Evx2 Rabbit Polyclonal Antibody (Biotin)

Evx2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Evx2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PRLPSAPLHGALGDLPAKGKFEIDTLFNLQHPSSESTVSSEIASATESRK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_221512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KC1 (NM_012424) Human Recombinant Protein
TP311142M 100 µg

RPS6KC1 (NM_012424) Human Recombinant Protein

Sign In for Pricing
View Details
SUN2 ORF Vector (Human) (pORF)
ORF033553 1.0 µg DNA

SUN2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PKC ν (C-1) P
sc-376024 P 100 µg - 0.5 mL

PKC ν (C-1) P

Sign In for Pricing
View Details
Lentiviral human OPN4 shRNA (UAS) - Lentiviral human OPN4 shRNA (UAS, iRFP) (25)
GTR15311033 1 Vial

Lentiviral human OPN4 shRNA (UAS) - Lentiviral human OPN4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SERPIND1 siRNA (Mouse)
orb1847499-01 15 nmol

SERPIND1 siRNA (Mouse)

Sign In for Pricing
View Details
SERPIND1 siRNA (Mouse)
orb1847499-02 30 nmol

SERPIND1 siRNA (Mouse)

Sign In for Pricing
View Details