Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIPK3 Rabbit Polyclonal Antibody (Biotin)

RIPK3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RIP3

UniProt

Q9Y572

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AQHRKWGYDVAVKIVNSKAISREVKAMASLDNEFVLRLEGVIEKVNWDQD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pituitary Cells
ARP0519 0.5 Million

Mouse Pituitary Cells

Sign In for Pricing
View Details
OR9G4, CT (OR9G4, Olfactory receptor 9G4, Olfactory receptor OR11-216) (MaxLight 750)
MBS6329546-01 0.1 mL

OR9G4, CT (OR9G4, Olfactory receptor 9G4, Olfactory receptor OR11-216) (MaxLight 750)

Sign In for Pricing
View Details
OR9G4, CT (OR9G4, Olfactory receptor 9G4, Olfactory receptor OR11-216) (MaxLight 750)
MBS6329546-02 5x 0.1 mL

OR9G4, CT (OR9G4, Olfactory receptor 9G4, Olfactory receptor OR11-216) (MaxLight 750)

Sign In for Pricing
View Details
TP53BP2, NT (TP53BP2, ASPP2, BBP, Apoptosis-stimulating of p53 protein 2, Bcl2-binding protein, Renal carcinoma antigen NY-REN-51, Tumor suppressor p53-binding protein 2)
MBS6012735-01 0.2 mL

TP53BP2, NT (TP53BP2, ASPP2, BBP, Apoptosis-stimulating of p53 protein 2, Bcl2-binding protein, Renal carcinoma antigen NY-REN-51, Tumor suppressor p53-binding protein 2)

Sign In for Pricing
View Details
TP53BP2, NT (TP53BP2, ASPP2, BBP, Apoptosis-stimulating of p53 protein 2, Bcl2-binding protein, Renal carcinoma antigen NY-REN-51, Tumor suppressor p53-binding protein 2)
MBS6012735-02 5x 0.2 mL

TP53BP2, NT (TP53BP2, ASPP2, BBP, Apoptosis-stimulating of p53 protein 2, Bcl2-binding protein, Renal carcinoma antigen NY-REN-51, Tumor suppressor p53-binding protein 2)

Sign In for Pricing
View Details
Donkey Goat IgG (H&L), Affinity purified, Unconjugated, min, cross-reactivity to human, mouse, rabbit, rat IgG Antibody
orb699976 1 mg

Donkey Goat IgG (H&L), Affinity purified, Unconjugated, min, cross-reactivity to human, mouse, rabbit, rat IgG Antibody

Sign In for Pricing
View Details