Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXO6 Rabbit Polyclonal Antibody (Biotin)

FOXO6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A8MYZ6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXO6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SURB7 (Mediator Complex Subunit 21, SRB7, SURB7)
252293 100 µg

SURB7 (Mediator Complex Subunit 21, SRB7, SURB7)

Sign In for Pricing
View Details
TSSK6, CT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 490)
MBS6359766-01 0.1 mL

TSSK6, CT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 490)

Sign In for Pricing
View Details
TSSK6, CT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 490)
MBS6359766-02 5x 0.1 mL

TSSK6, CT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 490)

Sign In for Pricing
View Details
HDAC2 Recombinant Rabbit mAb
orb2326624-01 25 µL

HDAC2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
HDAC2 Recombinant Rabbit mAb
orb2326624-02 50 µL

HDAC2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
HDAC2 Recombinant Rabbit mAb
orb2326624-03 100 µL

HDAC2 Recombinant Rabbit mAb

Sign In for Pricing
View Details