Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mnx1 Rabbit Polyclonal Antibody (FITC)

Mnx1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MN, HB9, Hlxb, MNR2, Hlxb9

UniProt

A2RSX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Mnx1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064328

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fer (C-1) Alexa Fluor® 647
sc-390484 AF647 200 µg/mL

Fer (C-1) Alexa Fluor® 647

Sign In for Pricing
View Details
SPATA7 3'UTR GFP Stable Cell Line
TU074410 1.0 mL

SPATA7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ETS1 Antibody, FITC conjugated
A20960-100UG 100 µg

ETS1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Monoclonal STEP Antibody (23E5) [mFluor Violet 500 SE]
NB300-202MFV500 0.1 mL

Mouse Monoclonal STEP Antibody (23E5) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal beta Amyloid Antibody [mFluor Violet 450 SE]
NBP2-25093MFV450 0.1 mL

Rabbit Polyclonal beta Amyloid Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
MYOM1 Human qPCR Primer Pair (NM_003803)
HP207256 200 Reactions

MYOM1 Human qPCR Primer Pair (NM_003803)

Sign In for Pricing
View Details