Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACADM Rabbit Polyclonal Antibody (FITC)

ACADM Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MCAD, ACAD1, MCADH

UniProt

P11310

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACADM

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_000007

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro
MBS6318314-01 0.1 mL

MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro

Sign In for Pricing
View Details
MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro
MBS6318314-02 5x 0.1 mL

MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro

Sign In for Pricing
View Details
Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1171083-01 0.02 mg (E-Coli)

Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1171083-02 0.02 mg (Yeast)

Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1171083-03 0.1 mg (E-Coli)

Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1171083-04 0.1 mg (Yeast)

Recombinant Brucella suis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details