Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBXIP1 Rabbit Polyclonal Antibody (FITC)

PBXIP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HPIP

UniProt

Q96AQ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PBXIP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGGEGAGGELGISLNMCLLGALVLLGLGVLLFSGGLSESETGPMEEVERQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065385

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPAS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
32037066 1.0 µg DNA

NPAS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Deiodinase, Iodothyronine, Type III ELISA Kit
MBS090947 Inquire

Rabbit Deiodinase, Iodothyronine, Type III ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella Sonnei efeB Protein (aa 36-423)
VAng-Lsx09650-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei efeB Protein (aa 36-423)

Sign In for Pricing
View Details
DRD2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-20730R-BF488 100 µL

DRD2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
MEKK1, CT (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (AP) discontinued
M2867-01C-AP 200 µL

MEKK1, CT (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (AP) discontinued

Sign In for Pricing
View Details
NR1H3 antibody - N-terminal region
MBS3204212-01 0.1 mL

NR1H3 antibody - N-terminal region

Sign In for Pricing
View Details