Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD2B Rabbit Polyclonal Antibody (HRP)

GATAD2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P68, GANDS, MRD18, P66beta

UniProt

Q8WXI9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GATAD2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065750

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Explorer™ Live Cell Tracking Kit *Blue Fluorescence*
22620-AAT 200 Tests

Cell Explorer™ Live Cell Tracking Kit *Blue Fluorescence*

Sign In for Pricing
View Details
Chlorhexidine EP Impurity O
TRC-C729840-100MG 100 mg

Chlorhexidine EP Impurity O

Sign In for Pricing
View Details
OR9Q2 (NM_001005283) Human Over-expression Lysate
LC423842 20 µg

OR9Q2 (NM_001005283) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Cyclopropyl-6,7-difluoro-1,4-dihydro-4-oxoquinoline-3-carboxylic Acid
TRC-C989685-500MG 500 mg

1-Cyclopropyl-6,7-difluoro-1,4-dihydro-4-oxoquinoline-3-carboxylic Acid

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF647 conjugate, 0.1mg/mL
BNC472701-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LRP2 Human Gene Knockout Kit (CRISPR)
KN213707BN 1 Kit

LRP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details