Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF398 Rabbit Polyclonal Antibody (HRP)

ZNF398 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P51, P71, ZER6

UniProt

B4E377

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF398

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065832

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMP Activated Protein Kinase beta1 (AMPK beta-1 Chain, AMPK Subunit beta-1, AMPK b1, AMPKb, 5'-AMP-activated Protein Kinase Subunit beta-1, HAMPKb, MGC17785, PRKAB1) discontinued
A1475-03 100 µg

AMP Activated Protein Kinase beta1 (AMPK beta-1 Chain, AMPK Subunit beta-1, AMPK b1, AMPKb, 5'-AMP-activated Protein Kinase Subunit beta-1, HAMPKb, MGC17785, PRKAB1) discontinued

Sign In for Pricing
View Details
REST, ID (REST, NRSF, XBR, RE1-silencing transcription factor, Neural-restrictive silencer factor, X2 box repressor) (FITC)
MBS6341337-01 0.2 mL

REST, ID (REST, NRSF, XBR, RE1-silencing transcription factor, Neural-restrictive silencer factor, X2 box repressor) (FITC)

Sign In for Pricing
View Details
REST, ID (REST, NRSF, XBR, RE1-silencing transcription factor, Neural-restrictive silencer factor, X2 box repressor) (FITC)
MBS6341337-02 5x 0.2 mL

REST, ID (REST, NRSF, XBR, RE1-silencing transcription factor, Neural-restrictive silencer factor, X2 box repressor) (FITC)

Sign In for Pricing
View Details
Myosin heavy chain (MHC) Human ELISA Kit
11176 96 Tests

Myosin heavy chain (MHC) Human ELISA Kit

Sign In for Pricing
View Details
COMMD2 Rabbit Polyclonal Antibody (Cy3)
orb985222 100 µL

COMMD2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Canine Calmodulin-binding transcription activator 2 (CAMTA2) ELISA Kit
MBS7223411-01 48 Well

Canine Calmodulin-binding transcription activator 2 (CAMTA2) ELISA Kit

Sign In for Pricing
View Details