Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF624 Rabbit Polyclonal Antibody (FITC)

ZNF624 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6ZN27

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF624

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINYSCLTVHHR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065838

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
TRV-0045160-01 20 µL

Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
TRV-0045160-02 100 µL

Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
TRV-0045160-03 200 µL

Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
TRV-0045160-04 1 mL

Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details
SLC22A18AS Rabbit Polyclonal Antibody
orb631237-01 50 µg

SLC22A18AS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A18AS Rabbit Polyclonal Antibody
orb631237-02 100 µg

SLC22A18AS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details