Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGZ Rabbit Polyclonal Antibody (HRP)

POGZ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRD37, WHSUS, ZNF635, ZNF280E, ZNF635m

UniProt

Q7Z3K3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POGZ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_665739

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Lysine-2,3,3,4,4,5,5,6,6-d9 Hydrochloride
TRC-L468908-25MG 25 mg

L-Lysine-2,3,3,4,4,5,5,6,6-d9 Hydrochloride

Sign In for Pricing
View Details
WIPI2 (2A2), CF647 conjugate, 0.1mg/mL
BNC472904-500 1x 500 µL

WIPI2 (2A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PMVK/phosphomevalonate kinase Monoclonal Antibody
AN300281P 100 µL

Recombinant PMVK/phosphomevalonate kinase Monoclonal Antibody

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2444), Biotin conjugate, 0.1mg/mL
BNCB2444-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2444), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB544900 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Human Coiled Coil Domain Containing Protein 80 (CCDC80) ELISA Kit
RDR-CCDC80-Hu-01 96 Tests

Human Coiled Coil Domain Containing Protein 80 (CCDC80) ELISA Kit

Sign In for Pricing
View Details