Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGZ Rabbit Polyclonal Antibody (HRP)

POGZ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRD37, WHSUS, ZNF635, ZNF280E, ZNF635m

UniProt

Q7Z3K3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POGZ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_665739

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Human CD19 Antibody[SJ25C1]
AN00334M-01 20 Tests

Elab Fluor® 647 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD19 Antibody[SJ25C1]
AN00334M-02 100 Tests

Elab Fluor® 647 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD19 Antibody[SJ25C1]
AN00334M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
METTL7A Rabbit Polyclonal Antibody
TA378485 100 µL

METTL7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p16INK4A (CDKN2A) (NM_000077) Human Recombinant Protein
TP320937 20 µg

p16INK4A (CDKN2A) (NM_000077) Human Recombinant Protein

Sign In for Pricing
View Details
ALAD (C-term) Rabbit Polyclonal Antibody
AP17099PU-N 400 µL

ALAD (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details