Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF706 Rabbit Polyclonal Antibody (HRP)

ZNF706 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSPC038, PNAS-106, PNAS-113

UniProt

Q9Y5V0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF706

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r61 (NM_001105058) Mouse Tagged ORF Clone
MG212998 10 µg

Vmn2r61 (NM_001105058) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Adamts20 (NM_001164785) Mouse Tagged Lenti ORF Clone
MR221442L3 10 µg

Adamts20 (NM_001164785) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sheep Leucine Aminopeptidase (LAP) ELISA Kit
abx364574 96 Well

Sheep Leucine Aminopeptidase (LAP) ELISA Kit

Sign In for Pricing
View Details
Adenosine A2b Receptor (ADORA2b) Magnetic Fluorescence Assay Kit
MBS2160344-01 96 Tests

Adenosine A2b Receptor (ADORA2b) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Adenosine A2b Receptor (ADORA2b) Magnetic Fluorescence Assay Kit
MBS2160344-02 5x 96 Tests

Adenosine A2b Receptor (ADORA2b) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Adenosine A2b Receptor (ADORA2b) Magnetic Fluorescence Assay Kit
MBS2160344-03 10x 96 Tests

Adenosine A2b Receptor (ADORA2b) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details