Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF706 Rabbit Polyclonal Antibody (HRP)

ZNF706 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSPC038, PNAS-106, PNAS-113

UniProt

Q9Y5V0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF706

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (MaxLight 650)
MBS6498167-01 0.1 mL

ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (MaxLight 650)

Sign In for Pricing
View Details
ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (MaxLight 650)
MBS6498167-02 5x 0.1 mL

ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (MaxLight 650)

Sign In for Pricing
View Details
CCL19 (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, MIP3B, SCYA19, MGC34433) (Biotin)
143658-Biotin 100 µL

CCL19 (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, MIP3B, SCYA19, MGC34433) (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal SRGAP1 Antibody
NBP2-13377 0.1 mL

Rabbit Polyclonal SRGAP1 Antibody

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae tRNA-specific 2-thiouridylase mnmA (mnmA)
MBS1040886-01 0.02 mg (E-Coli)

Recombinant Thermotoga lettingae tRNA-specific 2-thiouridylase mnmA (mnmA)

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae tRNA-specific 2-thiouridylase mnmA (mnmA)
MBS1040886-02 0.02 mg (Yeast)

Recombinant Thermotoga lettingae tRNA-specific 2-thiouridylase mnmA (mnmA)

Sign In for Pricing
View Details