Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX30 Rabbit Polyclonal Antibody (Biotin)

SOX30 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O94993

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SOX30

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GDEKGKLEAEEVMRDSMQGGAGKSPAAIREGVIKTEEPERLLEDCRLGAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_008948

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rnf181 Pre-designed siRNA Set B
SI112100B 1 Each

Mouse Rnf181 Pre-designed siRNA Set B

Sign In for Pricing
View Details
NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) (APC)
130295-APC 100 µL

NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) (APC)

Sign In for Pricing
View Details
Rabbit anti-LANCL1 Antibody, Affinity Purified
MBS3904657-01 0.01 mg

Rabbit anti-LANCL1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-LANCL1 Antibody, Affinity Purified
MBS3904657-02 0.1 mg

Rabbit anti-LANCL1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-LANCL1 Antibody, Affinity Purified
MBS3904657-03 5x 0.01 mg

Rabbit anti-LANCL1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-LANCL1 Antibody, Affinity Purified
MBS3904657-04 5x 0.1 mg

Rabbit anti-LANCL1 Antibody, Affinity Purified

Sign In for Pricing
View Details