Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1B Rabbit Polyclonal Antibody (HRP)

HNF1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

T2D, FJHN, HNF2, LFB3, RCAD, TCF2, HPC11, LF-B3, MODY5, TCF-2, VHNF1, ADTKD3, HNF-1B, HNF1beta, HNF-1-beta

UniProt

P35680

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000449

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAcrp30 Variant
100-174a 25 µg

GAcrp30 Variant

Sign In for Pricing
View Details
MyoD Lentiviral Activation Particles (h2)
sc-400092-LAC-2 200 µL

MyoD Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
SACS Rabbit Polyclonal Antibody
APRab17571-01 20 µL

SACS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SACS Rabbit Polyclonal Antibody
APRab17571-02 50 µL

SACS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SACS Rabbit Polyclonal Antibody
APRab17571-03 100 µL

SACS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SACS Rabbit Polyclonal Antibody
APRab17571-04 200 µL

SACS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details