Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTRAP Rabbit Polyclonal Antibody (FITC)

TTRAP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EAP2, AD022, EAPII, TTRAP, hTDP2, dJ30M3.3

UniProt

O95551

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TTRAP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057698

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)
MBS1352265-01 0.02 mg (E-Coli)

Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)
MBS1352265-02 0.1 mg (E-Coli)

Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)
MBS1352265-03 0.02 mg (Yeast)

Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)
MBS1352265-04 0.1 mg (Yeast)

Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)
MBS1352265-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)
MBS1352265-06 0.02 mg (Mammalian-Cell)

Recombinant Pseudomonas fluorescens Probable transcriptional regulatory protein Pfl01_3677 (Pfl01_3677)

Sign In for Pricing
View Details