Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLD2 Rabbit Polyclonal Antibody (HRP)

PLD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PLD1C

UniProt

O14939

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PLD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_002654

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7) (APC)
122949-APC 100 µL

ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7) (APC)

Sign In for Pricing
View Details
Anti-COMT Polyclonal Antibody
PHD49101 100 μg

Anti-COMT Polyclonal Antibody

Sign In for Pricing
View Details
Abamectin Rapid Test Kit
SC-NC-011 20 Tests/Box

Abamectin Rapid Test Kit

Sign In for Pricing
View Details
COMMD9 Antibody
orb354443-01 50 µg

COMMD9 Antibody

Sign In for Pricing
View Details
COMMD9 Antibody
orb354443-02 100 µg

COMMD9 Antibody

Sign In for Pricing
View Details
NUDT2 (Nudix-type Motif 2, APAH1, Bis (5'-nucleosyl) -tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1, P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (H
MBS6153889-01 0.1 mL

NUDT2 (Nudix-type Motif 2, APAH1, Bis (5'-nucleosyl) -tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1, P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (H

Sign In for Pricing
View Details