Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLRG1 Rabbit Polyclonal Antibody (FITC)

PLRG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cwc1, PRL1, PRP46, PRPF46, TANGO4

UniProt

O43660

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLRG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002660

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti KRT20 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (Western Blot,IHC)
IRBAMLKRT20AP067200UL 1 Each

Rabbit Anti KRT20 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (Western Blot,IHC)

Sign In for Pricing
View Details
IR 26 (Dye 26)
TRC-I749015-100MG 100 mg

IR 26 (Dye 26)

Sign In for Pricing
View Details
Human Calcium binding and coiled coil domain containing protein 2 (CALCOCO2) ELISA kit
GTR10404885 96 Well

Human Calcium binding and coiled coil domain containing protein 2 (CALCOCO2) ELISA kit

Sign In for Pricing
View Details
CRYGA sgRNA CRISPR Lentivector (Human) (Target 2)
K0512203 1.0 µg DNA

CRYGA sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Porcine Coiled coil domain containing protein 74B (CCDC74B) ELISA Kit
GTR10329490 96 Well

Porcine Coiled coil domain containing protein 74B (CCDC74B) ELISA Kit

Sign In for Pricing
View Details
Phospho-GSK3A-S21 Rabbit pAb
MBS8550662-01 0.1 mL

Phospho-GSK3A-S21 Rabbit pAb

Sign In for Pricing
View Details