Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC38A2 Rabbit Polyclonal Antibody (FITC)

SLC38A2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ATA2, SAT2, SNAT2, PRO1068

UniProt

Q96QD8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PLCE1 Antibody
A02360 100 µL

Anti-PLCE1 Antibody

Sign In for Pricing
View Details
SLS Lab Basics 12 Channel Pipette 0.5 - 10uL
SLS4936 1 Each

SLS Lab Basics 12 Channel Pipette 0.5 - 10uL

Sign In for Pricing
View Details
OR2W1 (NM_030903) Human Over-expression Lysate
LH12418V 100 µg

OR2W1 (NM_030903) Human Over-expression Lysate

Sign In for Pricing
View Details
MEGF9, CT (MEGF9, EGFL5, KIAA0818, Multiple epidermal growth factor-like domains protein 9, Epidermal growth factor-like protein 5) (FITC)
MBS6320147-01 0.2 mL

MEGF9, CT (MEGF9, EGFL5, KIAA0818, Multiple epidermal growth factor-like domains protein 9, Epidermal growth factor-like protein 5) (FITC)

Sign In for Pricing
View Details
MEGF9, CT (MEGF9, EGFL5, KIAA0818, Multiple epidermal growth factor-like domains protein 9, Epidermal growth factor-like protein 5) (FITC)
MBS6320147-02 5x 0.2 mL

MEGF9, CT (MEGF9, EGFL5, KIAA0818, Multiple epidermal growth factor-like domains protein 9, Epidermal growth factor-like protein 5) (FITC)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)
MBS2144340-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Chaperonin Containing TCP1, Subunit 2 (CCT2)

Sign In for Pricing
View Details