Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC38A2 Rabbit Polyclonal Antibody (HRP)

SLC38A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATA2, SAT2, SNAT2, PRO1068

UniProt

Q96QD8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLOCK Recombinant Rabbit Monoclonal Antibody [JA12-33]
ET1704-82 100 µL

CLOCK Recombinant Rabbit Monoclonal Antibody [JA12-33]

Sign In for Pricing
View Details
EIF5A2 (NM_020390) Human Recombinant Protein
TP306249L 1 mg

EIF5A2 (NM_020390) Human Recombinant Protein

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF740 conjugate, 0.1mg/mL
BNC743006-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant TIA1 Antibody
RC-16723-01 50 μL

Recombinant TIA1 Antibody

Sign In for Pricing
View Details
Recombinant TIA1 Antibody
RC-16723-02 100 µL

Recombinant TIA1 Antibody

Sign In for Pricing
View Details
Recombinant TIA1 Antibody
RC-16723-03 1 mL

Recombinant TIA1 Antibody

Sign In for Pricing
View Details