Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f1 Rabbit Polyclonal Antibody (FITC)

Pou3f1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Otf6, Scip, Oct-6, Tst-1, Testes-1

UniProt

P20267

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant E.coli Agmatinase Protein, His-SUMO, E.coli-100ug
QP5622-ec-100ug 100ug

Recombinant E.coli Agmatinase Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details
PRMT3 CRISPR/Cas9 KO Plasmid (h)
sc-406688 20 µg

PRMT3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
IVD Recombinant Protein (Rat)
RP206471 100 µg

IVD Recombinant Protein (Rat)

Sign In for Pricing
View Details
Phospho-IKB epsilon (Ser157) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5517R-BF647 100 µL

Phospho-IKB epsilon (Ser157) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
RBBP7, Recombinant, Human, aa1-425, His-SUMO-Tag (Histone-binding Protein RBBP7)
374997-01 20 µg

RBBP7, Recombinant, Human, aa1-425, His-SUMO-Tag (Histone-binding Protein RBBP7)

Sign In for Pricing
View Details
RBBP7, Recombinant, Human, aa1-425, His-SUMO-Tag (Histone-binding Protein RBBP7)
374997-02 100 µg

RBBP7, Recombinant, Human, aa1-425, His-SUMO-Tag (Histone-binding Protein RBBP7)

Sign In for Pricing
View Details