Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou4f3 Rabbit Polyclonal Antibody (HRP)

Pou4f3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Brn, ddl, Brn3, Brn-3, Brn3c, Brn3.1, dreidel

UniProt

Q63955

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620395

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF405S conjugate, 0.1mg/mL
BNC041563-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Nmt2 activation kit by CRISPRa
GA202922 1 Kit

Mouse Nmt2 activation kit by CRISPRa

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF568 conjugate, 0.1mg/mL
BNC682062-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624999 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
RNMTL1 (MRM3) (NM_018146) Human Recombinant Protein
TP304113 20 µg

RNMTL1 (MRM3) (NM_018146) Human Recombinant Protein

Sign In for Pricing
View Details
Uncoated Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
E-UNEL-H0034-01 5x 96 Tests

Uncoated Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details