Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APP Rabbit Polyclonal Antibody (Biotin)

APP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AAA, AD1, PN2, ABPP, APPI, CVAP, ABETA, PN-II, preA4, CTFgamma, alpha-sAPP

UniProt

P05067

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human APP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_958817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit
MBS7208742-01 48 Well

Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit

Sign In for Pricing
View Details
Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit
MBS7208742-02 96 Well

Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit

Sign In for Pricing
View Details
Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit
MBS7208742-03 5x 96 Well

Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit

Sign In for Pricing
View Details
Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit
MBS7208742-04 10x 96 Well

Mouse ion channel sperm-associated protein 3 (SPER3) ELISA Kit

Sign In for Pricing
View Details
2,2'-[ (3,5-Diamino-2,6-pyridinediyl) bis (oxy) ]bisethanol Dihydrochloride
419464-01 100 mg

2,2'-[ (3,5-Diamino-2,6-pyridinediyl) bis (oxy) ]bisethanol Dihydrochloride

Sign In for Pricing
View Details
2,2'-[ (3,5-Diamino-2,6-pyridinediyl) bis (oxy) ]bisethanol Dihydrochloride
419464-02 1 g

2,2'-[ (3,5-Diamino-2,6-pyridinediyl) bis (oxy) ]bisethanol Dihydrochloride

Sign In for Pricing
View Details