Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APP Rabbit Polyclonal Antibody (FITC)

APP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AAA, AD1, PN2, ABPP, APPI, CVAP, ABETA, PN-II, preA4, CTFgamma, alpha-sAPP

UniProt

P05067

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human APP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000475

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGNETIC BEAD SEPARATION PLATE, 24 or 96 Well, Standard or Deep Well Plate, Round or Conical or Pyramid Bottom, 7 Bars, 50MGO, NdFeB Magnets, White Polycarbonate Magnet Frame, 1 Sided Pellet Location, Bar 3mm Wide, Axial - Alternating North-To-South Magnetic Orientation, Center Magnet with Notch, SLAS Footprint, Includes Registration Base
VP 771MWZM-1-ALT 1 EACH

MAGNETIC BEAD SEPARATION PLATE, 24 or 96 Well, Standard or Deep Well Plate, Round or Conical or Pyramid Bottom, 7 Bars, 50MGO, NdFeB Magnets, White Polycarbonate Magnet Frame, 1 Sided Pellet Location, Bar 3mm Wide, Axial - Alternating North-To-South Magnetic Orientation, Center Magnet with Notch, SLAS Footprint, Includes Registration Base

Sign In for Pricing
View Details
YWHAQP6 ORF Vector (Human) (pORF)
ORF036034 1.0 µg DNA

YWHAQP6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
WWC1, NT (WWC1, KIAA0869, Protein KIBRA, HBeAg-binding protein 3, Kidney and brain protein, WW domain-containing protein 1)
043903 200 µL

WWC1, NT (WWC1, KIAA0869, Protein KIBRA, HBeAg-binding protein 3, Kidney and brain protein, WW domain-containing protein 1)

Sign In for Pricing
View Details
Leptin receptor Rabbit Polyclonal Antibody (BF488)
orb1581485 100 µL

Leptin receptor Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Anti-ACAD9 Rabbit pAb
GB113931-100 100 μL

Anti-ACAD9 Rabbit pAb

Sign In for Pricing
View Details
Specimen bag, ziplock, 6x9"
4919 1000/CS

Specimen bag, ziplock, 6x9"

Sign In for Pricing
View Details