Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOP2B Rabbit Polyclonal Antibody (FITC)

TOP2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TOPIIB, top2beta

UniProt

Q02880

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TOP2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

183kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neural cell adhesion molecule 1, NCAM1 ELISA KIT
ELI-04056h 96 Tests

Human Neural cell adhesion molecule 1, NCAM1 ELISA KIT

Sign In for Pricing
View Details
TOP3B (DNA Topoisomerase 3-beta-1, DNA Topoisomerase III beta-1, TOP3B1) (FITC)
134612-FITC 100 µL

TOP3B (DNA Topoisomerase 3-beta-1, DNA Topoisomerase III beta-1, TOP3B1) (FITC)

Sign In for Pricing
View Details
Anti-SPATA5 Antibody Picoband®, Cy3 Conjugate
A06364-1-Cy3 100 µg/Vial

Anti-SPATA5 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Phospholipase A2 (membrane associated (PLA2G2A) Bovine ELISA Kit
F8607 96 Tests

Phospholipase A2 (membrane associated (PLA2G2A) Bovine ELISA Kit

Sign In for Pricing
View Details
Recombinant Polynucleobacter sp. 3-dehydroquinate dehydratase (aroQ)
MBS1120940-01 0.02 mg (E-Coli)

Recombinant Polynucleobacter sp. 3-dehydroquinate dehydratase (aroQ)

Sign In for Pricing
View Details
Recombinant Polynucleobacter sp. 3-dehydroquinate dehydratase (aroQ)
MBS1120940-02 0.1 mg (E-Coli)

Recombinant Polynucleobacter sp. 3-dehydroquinate dehydratase (aroQ)

Sign In for Pricing
View Details