Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOP2B Rabbit Polyclonal Antibody (HRP)

TOP2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TOPIIB, top2beta

UniProt

Q02880

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TOP2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

183kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum for 293 Cell Culture
C6002F-500ml 500 mL

Serum for 293 Cell Culture

Sign In for Pricing
View Details
SLC45A3, ID (SLC45A3, PCANAP6, PRST, Solute carrier family 45 member 3, Prostate cancer-associated protein 6, Prostein) (AP)
MBS6348462-01 0.2 mL

SLC45A3, ID (SLC45A3, PCANAP6, PRST, Solute carrier family 45 member 3, Prostate cancer-associated protein 6, Prostein) (AP)

Sign In for Pricing
View Details
SLC45A3, ID (SLC45A3, PCANAP6, PRST, Solute carrier family 45 member 3, Prostate cancer-associated protein 6, Prostein) (AP)
MBS6348462-02 5x 0.2 mL

SLC45A3, ID (SLC45A3, PCANAP6, PRST, Solute carrier family 45 member 3, Prostate cancer-associated protein 6, Prostein) (AP)

Sign In for Pricing
View Details
ASGR1 Rabbit Polyclonal Antibody
orb624906-01 50 µg

ASGR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASGR1 Rabbit Polyclonal Antibody
orb624906-02 100 µg

ASGR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Guinea pig recombination activating gene 2 (RAG-2) ELISA Kit
MBS260653-01 48 Well

Guinea pig recombination activating gene 2 (RAG-2) ELISA Kit

Sign In for Pricing
View Details