Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCG1 Rabbit Polyclonal Antibody (FITC)

PLCG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1

UniProt

P19174

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLCG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEF

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

141 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Enamelin (ENAM) ELISA Kit
abx384828 96 Tests

Human Enamelin (ENAM) ELISA Kit

Sign In for Pricing
View Details
GBX1 Double Nickase Plasmid (m)
sc-433030-NIC 20 µg

GBX1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human OTC shRNA (UAS) - Lentiviral human OTC shRNA (UAS) (25)
GTR15134933 1 Vial

Lentiviral human OTC shRNA (UAS) - Lentiviral human OTC shRNA (UAS) (25)

Sign In for Pricing
View Details
FBXO24 Rabbit Polyclonal Antibody (FITC)
orb2120802 100 µL

FBXO24 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
N, N-Bis (1-Phenylethyl) -4,5,6,7-Tetrahydrodiindeno[7,1-De:1',7'-Fg][1,3,2]Dioxaphosphocin-12-Amine
OR1026581-01 100 mg

N, N-Bis (1-Phenylethyl) -4,5,6,7-Tetrahydrodiindeno[7,1-De:1',7'-Fg][1,3,2]Dioxaphosphocin-12-Amine

Sign In for Pricing
View Details
N, N-Bis (1-Phenylethyl) -4,5,6,7-Tetrahydrodiindeno[7,1-De:1',7'-Fg][1,3,2]Dioxaphosphocin-12-Amine
OR1026581-02 250 mg

N, N-Bis (1-Phenylethyl) -4,5,6,7-Tetrahydrodiindeno[7,1-De:1',7'-Fg][1,3,2]Dioxaphosphocin-12-Amine

Sign In for Pricing
View Details