Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1A Rabbit Polyclonal Antibody (Biotin)

HSPA1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSP72, HSPA1, HSP70I, HSP70-1, HSP70-2, HSP70.1, HSP70.2, HSP70-1A, HEL-S-103

UniProt

P08107

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPA1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

CAI18465

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRABD2A qPCR Primer Pair
QH62189S 200 Tests

Human TRABD2A qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral mouse Ccl11 shRNA (UAS) - Lentiviral mouse Ccl11 shRNA (UAS, iRFP) plasmid
GTR15296671 1 Vial

Lentiviral mouse Ccl11 shRNA (UAS) - Lentiviral mouse Ccl11 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Bovine L-Lactic dehydrogenase Antibody
orb20927 10 mg

Rabbit Bovine L-Lactic dehydrogenase Antibody

Sign In for Pricing
View Details
Human WNT5B qPCR Primer Pair
QH09161S 200 Tests

Human WNT5B qPCR Primer Pair

Sign In for Pricing
View Details
Phospho-Flt3 / CD135 (Tyr589) Blocking Peptide
MBS9619116-01 1 mg

Phospho-Flt3 / CD135 (Tyr589) Blocking Peptide

Sign In for Pricing
View Details
Phospho-Flt3 / CD135 (Tyr589) Blocking Peptide
MBS9619116-02 5x 1 mg

Phospho-Flt3 / CD135 (Tyr589) Blocking Peptide

Sign In for Pricing
View Details