Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMA1 Rabbit Polyclonal Antibody (HRP)

PNMA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MA1

UniProt

Q8ND90

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PNMA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006020

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein Recombinant Rabbit Monoclonal Antibody [SN06-42]
ET1611-30 100 µL

P Glycoprotein Recombinant Rabbit Monoclonal Antibody [SN06-42]

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), CF640R conjugate, 0.1mg/mL
BNC403435-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Griffonia simplicifolia Gel -GS-I- Immobilized Lectin
AK-2401-2 2 mL

Griffonia simplicifolia Gel -GS-I- Immobilized Lectin

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502775 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H10]
TA801004BM 100 µL

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H10]

Sign In for Pricing
View Details
RBPJK (RBPJ) Rabbit Monoclonal Antibody [Clone ID: R05-6G4]
TA385148 100 µL

RBPJK (RBPJ) Rabbit Monoclonal Antibody [Clone ID: R05-6G4]

Sign In for Pricing
View Details