Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IVNS1ABP Rabbit Polyclonal Antibody (Biotin)

IVNS1ABP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ND1, ARA3, NS-1, IMD70, NS1BP, FLARA3, KLHL39, NS1-BP, HSPC068

UniProt

Q9Y6Y0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SingleFlowEx CD25 PE-Cy™7
ED7744 1 mL

SingleFlowEx CD25 PE-Cy™7

Sign In for Pricing
View Details
Chewing (bitting) mouth parts
4040360/A 1 Each

Chewing (bitting) mouth parts

Sign In for Pricing
View Details
Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit
MBS7218447-01 48 Well

Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit

Sign In for Pricing
View Details
Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit
MBS7218447-02 96 Well

Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit

Sign In for Pricing
View Details
Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit
MBS7218447-03 5x 96 Well

Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit

Sign In for Pricing
View Details
Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit
MBS7218447-04 10x 96 Well

Rat Centrosome and spindle pole-associated protein 1 (CSPP1) ELISA Kit

Sign In for Pricing
View Details