Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IVNS1ABP Rabbit Polyclonal Antibody (HRP)

IVNS1ABP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ND1, ARA3, NS-1, IMD70, NS1BP, FLARA3, KLHL39, NS1-BP, HSPC068

UniProt

Q9Y6Y0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit
RDR-ALOXE3-Hu-01 96 Tests

Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit

Sign In for Pricing
View Details
Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit
RDR-ALOXE3-Hu-02 48 Tests

Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit

Sign In for Pricing
View Details
Mettl4 Mouse Gene Knockout Kit (CRISPR)
KN310008RB 1 Kit

Mettl4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL3RA/CD123 Recombinant Rabbit monoclonal Antibody
HA723352 100 µL

Human IL3RA/CD123 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GTF2F2 Polyclonal Antibody
E-AB-64677-01 60 µL

GTF2F2 Polyclonal Antibody

Sign In for Pricing
View Details
GTF2F2 Polyclonal Antibody
E-AB-64677-02 120 µL

GTF2F2 Polyclonal Antibody

Sign In for Pricing
View Details