Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR75 Rabbit Polyclonal Antibody (FITC)

GPR75 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GPRchr2, WI31133

UniProt

O95800

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR75

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit
MBS2512722-01 24 Tests

Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit

Sign In for Pricing
View Details
Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit
MBS2512722-02 48 Tests

Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit

Sign In for Pricing
View Details
Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit
MBS2512722-03 96 Tests

Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit

Sign In for Pricing
View Details
Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit
MBS2512722-04 5x 96 Tests

Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit

Sign In for Pricing
View Details
Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit
MBS2512722-05 10x 96 Tests

Sheep CLEC2C (C-Type Lectin Domain Family 2 Member C) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human GSTM2 Protein, N-His
YHD77001 100 μg

Recombinant Human GSTM2 Protein, N-His

Sign In for Pricing
View Details