Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR75 Rabbit Polyclonal Antibody (HRP)

GPR75 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPRchr2, WI31133

UniProt

O95800

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR75

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IACS-8968 S-enantiomer 10mg
A21559-10 10 mg

IACS-8968 S-enantiomer 10mg

Sign In for Pricing
View Details
CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)
MBS6469055-01 0.1 mL

CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)

Sign In for Pricing
View Details
CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)
MBS6469055-02 5x 0.1 mL

CIDE-A, CT (Cell Death-inducing DFF-like Effector A) (PE)

Sign In for Pricing
View Details
Human Thy1 Cell Surface Antigen (Thy1) Antibody Pair Kit (with Standard)
MBS2100326-01 5x 96 Tests

Human Thy1 Cell Surface Antigen (Thy1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Thy1 Cell Surface Antigen (Thy1) Antibody Pair Kit (with Standard)
MBS2100326-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Thy1 Cell Surface Antigen (Thy1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Thy1 Cell Surface Antigen (Thy1) Antibody Pair Kit (with Standard)
MBS2100326-03 10x 96 Tests

Human Thy1 Cell Surface Antigen (Thy1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details