Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP2 Rabbit Polyclonal Antibody (HRP)

ARFIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

POR1

UniProt

P53365

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARFP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

XP_005252897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPP Antibody
OASA03221-200UG 0.2 mg

ALPP Antibody

Sign In for Pricing
View Details
IKK alpha, phosphorylated (Ser176, Ser180) (IKKa, IKK1, IkappaB Kinase alpha, Conserved Helix Loop Helix Ubiquitous Kinase, CHUK1, IkappaB Kinase 1, IkB Kinase alpha, IKBKa, IKK1, Inhibitor Of kappa Light Polypeptide Gene Enhancer In B Cells, Inhibitor Of Nuclear Factor kappa B Kinase alpha, NFKBIKa, TCF16) (HRP) discontinued
I3000-07M-HRP 100 µL

IKK alpha, phosphorylated (Ser176, Ser180) (IKKa, IKK1, IkappaB Kinase alpha, Conserved Helix Loop Helix Ubiquitous Kinase, CHUK1, IkappaB Kinase 1, IkB Kinase alpha, IKBKa, IKK1, Inhibitor Of kappa Light Polypeptide Gene Enhancer In B Cells, Inhibitor Of Nuclear Factor kappa B Kinase alpha, NFKBIKa, TCF16) (HRP) discontinued

Sign In for Pricing
View Details
PROX1 (prospero Homeobox 1) (MaxLight 550)
250531-ML550 100 µL

PROX1 (prospero Homeobox 1) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Monoclonal GSTM2 Antibody (CPTC-GSTMu2-2) [DyLight 488]
NBP3-08255G 100 µL

Mouse Monoclonal GSTM2 Antibody (CPTC-GSTMu2-2) [DyLight 488]

Sign In for Pricing
View Details
(R) -1,1'-Bi-2-Naphthol
261657-01 25 g

(R) -1,1'-Bi-2-Naphthol

Sign In for Pricing
View Details
(R) -1,1'-Bi-2-Naphthol
261657-02 50 g

(R) -1,1'-Bi-2-Naphthol

Sign In for Pricing
View Details