Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR5A Rabbit Polyclonal Antibody (FITC)

HTR5A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

5-HT5A

UniProt

P47898

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HTR5A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_076917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FA (HIST1H3A) pSer10 Rabbit Polyclonal Antibody
AP02460PU-S 50 µL

H3FA (HIST1H3A) pSer10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZCCHC12, CT (ZCCHC12, SIZN1, Zinc finger CCHC domain-containing protein 12, Smad-interacting zinc finger protein 1) (AP)
MBS6364886-01 0.2 mL

ZCCHC12, CT (ZCCHC12, SIZN1, Zinc finger CCHC domain-containing protein 12, Smad-interacting zinc finger protein 1) (AP)

Sign In for Pricing
View Details
ZCCHC12, CT (ZCCHC12, SIZN1, Zinc finger CCHC domain-containing protein 12, Smad-interacting zinc finger protein 1) (AP)
MBS6364886-02 5x 0.2 mL

ZCCHC12, CT (ZCCHC12, SIZN1, Zinc finger CCHC domain-containing protein 12, Smad-interacting zinc finger protein 1) (AP)

Sign In for Pricing
View Details
EBF1 CRISPR Knock Out 293T Cell Line (Human)
18865141 1x 10^6 Cells / 1.0 mL

EBF1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Eme1 (A-9) HRP
sc-393363 HRP 200 µg/mL

Eme1 (A-9) HRP

Sign In for Pricing
View Details
RBM11 Antibody
MBS1493032-01 0.05 mg

RBM11 Antibody

Sign In for Pricing
View Details