Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR5A Rabbit Polyclonal Antibody (HRP)

HTR5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

5-HT5A

UniProt

P47898

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HTR5A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_076917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5AK3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1515507 1.0 µg DNA

OR5AK3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Porcine Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit
YP-W80992-01 48 Tests

Porcine Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit

Sign In for Pricing
View Details
Porcine Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit
YP-W80992-02 96 Tests

Porcine Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit

Sign In for Pricing
View Details
ZCWCC1 Polyclonal Antibody, APC Conjugated
bs-25177R-APC 100 µL

ZCWCC1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Hair cortex Cytokeratin Rabbit Polyclonal Antibody (BF647)
orb2500386 100 µL

Hair cortex Cytokeratin Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Mouse neutrophil activating protein-2, NAP-2 ELISA Kit
CK-bio-16663-01 48 Tests

Mouse neutrophil activating protein-2, NAP-2 ELISA Kit

Sign In for Pricing
View Details