Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fa2h Rabbit Polyclonal Antibody (HRP)

Fa2h Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAAH, Faxdc, Faxdc1, G630055L08Rik

UniProt

Q5MPP0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_835187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL36A/IL-1F6 Polyclonal Antibody
PHJ75601 100 μg

Anti-IL36A/IL-1F6 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-alpha 1 Fetoprotein/AFP Antibody Picoband®, Cy3 Conjugate
A00522-3-Cy3 100 µg/Vial

Anti-alpha 1 Fetoprotein/AFP Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Recombinant Human CD318/CDCP1 Protein, N-His
orb3154671-01 50 µg

Recombinant Human CD318/CDCP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD318/CDCP1 Protein, N-His
orb3154671-02 100 µg

Recombinant Human CD318/CDCP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD318/CDCP1 Protein, N-His
orb3154671-03 1 mg

Recombinant Human CD318/CDCP1 Protein, N-His

Sign In for Pricing
View Details
Gamma-aminobutyric acid receptor subunit alpha-2
orb1640839-01 50 µg

Gamma-aminobutyric acid receptor subunit alpha-2

Sign In for Pricing
View Details