Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2N Rabbit Polyclonal Antibody (FITC)

UBE2N Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UBC13, UbcH13, HEL-S-71, UbcH-ben, UBCHBEN; UBC13

UniProt

P61088

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBE2N

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003339

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)
MBS2059706-01 0.1 mL

PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)
MBS2059706-02 0.2 mL

PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)
MBS2059706-03 0.5 mL

PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)
MBS2059706-04 1 mL

PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)
MBS2059706-05 5 mL

PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)
MBS2059706-06 5x 5 mL

PE-Linked Polyclonal Antibody to Netrin 4 (Ntn4)

Sign In for Pricing
View Details