Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASZ1 Rabbit Polyclonal Antibody (HRP)

CASZ1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CST, SRG, CAS11, ZNF693, dJ734G22.1

UniProt

Q86V15

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CASZ1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

125kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_060236

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S) - (+) -10-Camphorsulfonic Acid Ethyl Ester
412788-01 250 mg

(1S) - (+) -10-Camphorsulfonic Acid Ethyl Ester

Sign In for Pricing
View Details
(1S) - (+) -10-Camphorsulfonic Acid Ethyl Ester
412788-02 2.5 g

(1S) - (+) -10-Camphorsulfonic Acid Ethyl Ester

Sign In for Pricing
View Details
Plekha8 3'UTR Luciferase Stable Cell Line
TU216391 1.0 mL

Plekha8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Histone H1 Antibody
orb2643346 100 µg

Recombinant Histone H1 Antibody

Sign In for Pricing
View Details
EXOSC1, CT (EXOSC1, CSL4, Exosome complex component CSL4, Exosome component 1) (FITC) discontinued
035271-FITC 200 µL

EXOSC1, CT (EXOSC1, CSL4, Exosome complex component CSL4, Exosome component 1) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Btrc activation kit by CRISPRa
GA200452 1 Kit

Mouse Btrc activation kit by CRISPRa

Sign In for Pricing
View Details