MZB1/PERP1, Human (HEK293, His)
MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, His) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
MZB1/PERP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mzb1-perp1-protein-human-hek293-his.html
Purity
96.00
Smiles
DRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSAT
Molecular Formula
51237 (Gene_ID) Q8WU39-1 (D23-T185) (Accession)
Molecular Weight
Approximately 19-23 kDa due to glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942227-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details