MZB1/PERP1, Human (HEK293, His)
MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, His) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
MZB1/PERP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mzb1-perp1-protein-human-hek293-his.html
Purity
96.00
Smiles
DRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSAT
Molecular Formula
51237 (Gene_ID) Q8WU39-1 (D23-T185) (Accession)
Molecular Weight
Approximately 19-23 kDa due to glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942076-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742810-500 1x 500 µL
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details