Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MZB1/PERP1, Human (HEK293, His)

MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, His) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

MZB1/PERP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mzb1-perp1-protein-human-hek293-his.html

Purity

96.00

Smiles

DRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSAT

Molecular Formula

51237 (Gene_ID) Q8WU39-1 (D23-T185) (Accession)

Molecular Weight

Approximately 19-23 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-100 1x 100 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-100 1x 100 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-100 1x 100 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details