Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MZB1/PERP1, Human (HEK293, His)

MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, His) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

MZB1/PERP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mzb1-perp1-protein-human-hek293-his.html

Purity

96.00

Smiles

DRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSAT

Molecular Formula

51237 (Gene_ID) Q8WU39-1 (D23-T185) (Accession)

Molecular Weight

Approximately 19-23 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAKMIP2 Rabbit Polyclonal Antibody (RBITC)
orb1041083 100 µL

JAKMIP2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Phospho-TIRAP (Tyr86) Polyclonal Antibody, Cy7 Conjugated
bs-7562R-Cy7 100 µL

Phospho-TIRAP (Tyr86) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Forkhead Box protein D3 (FOXD3) Rat ELISA Kit
D4837 96 Tests

Forkhead Box protein D3 (FOXD3) Rat ELISA Kit

Sign In for Pricing
View Details
Formyl-HIST1H2AG (K95) Antibody
A24823-100UL 100 µL

Formyl-HIST1H2AG (K95) Antibody

Sign In for Pricing
View Details
HMGB1 Recombinant Rabbit mAb, APC-Cy5.5 conjugated
orb3000605 100 µL

HMGB1 Recombinant Rabbit mAb, APC-Cy5.5 conjugated

Sign In for Pricing
View Details
KLK12 Antibody
47-166 0.1 mg

KLK12 Antibody

Sign In for Pricing
View Details